PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000289018
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 800aa    MW: 89326.9 Da    PI: 5.3426
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000289018genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.21.8e-082065346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT  Ed+ + +a  ++  +   +W++Ia++++ g+t+k++ +++ +
    MDP0000289018 20 PWTRLEDKVFEQALVRFSEDlpnRWERIAEELP-GKTPKEVLEHYED 65
                     8****************999*************.**********976 PP

2Myb_DNA-binding44.63.4e-14113157347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W++I+r +  +Rt+ q+ s+ qky
    MDP0000289018 113 PWTEEEHKLFLIGLKKFGKGDWRSISRNVVVTRTPTQVASHAQKY 157
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512948.091371IPR017930Myb domain
SMARTSM007171.3E-81769IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-71767IPR009057Homeodomain-like
SuperFamilySSF466892.73E-111975IPR009057Homeodomain-like
CDDcd001671.31E-72067No hitNo description
PfamPF002499.1E-72066IPR001005SANT/Myb domain
PROSITE profilePS5129420.027106162IPR017930Myb domain
SuperFamilySSF466893.52E-16108163IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-16109161IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-10110156IPR009057Homeodomain-like
SMARTSM007172.5E-11110160IPR001005SANT/Myb domain
CDDcd001673.53E-9113158No hitNo description
PfamPF002495.9E-12113157IPR001005SANT/Myb domain
PROSITE profilePS5029410.153368431IPR017986WD40-repeat-containing domain
Gene3DG3DSA:2.130.10.104.4E-25368438IPR015943WD40/YVTN repeat-like-containing domain
SuperFamilySSF509788.06E-27368662IPR017986WD40-repeat-containing domain
SMARTSM003200.034381422IPR001680WD40 repeat
PROSITE profilePS5008210.041397431IPR001680WD40 repeat
SMARTSM00320480490528IPR001680WD40 repeat
Gene3DG3DSA:2.130.10.104.4E-25497653IPR015943WD40/YVTN repeat-like-containing domain
SMARTSM00320250565612IPR001680WD40 repeat
SMARTSM003200.078614653IPR001680WD40 repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 800 aa     Download sequence    Send to blast
MFQETAPCWS SVVQSAASTP WTRLEDKVFE QALVRFSEDL PNRWERIAEE LPGKTPKEVL  60
EHYEDLVHDV LEIDSGRVNL PSYADESMVG WEDTASQITF GSNREPERKK GTPWTEEEHK  120
LFLIGLKKFG KGDWRSISRN VVVTRTPTQV ASHAQKYFLR QTSMKKERKR SSIHDITTVE  180
SNSVSVPADR NWIPPPAVPV HQSPLQHLTQ QSHLPDQGDL SGYQDFGYPI VAGPKALVWA  240
RGNFRTDQTG NKSFQRRKRC SKTDSTLESA SAVDRAPRPR EERLHGITIT RLNFHDPLQG  300
DFPEVIEEYL EYGVMKCIAF NRRGTLLADW LVIXFKVQAY GMTYFQCTPV STMNVATKLK  360
ARXYAQPGCS DGNCIVWDFE TRGIAKELRD RDCVAAITSV CWSKYGHRIL VSAADKSLTL  420
WDVVSGEKIT RTILQQTPLQ ARLHPGSSFP SLCLACPLSS APIIVDLNTG STVVLPVSIP  480
DSNPGLVPPP RNKISEGSPP FSPTAACFNK YGDLVYAGNS KGEILVIDYK SIQVRAMVPT  540
SGVSVIKNIE XLDGIDGVEK LKAVGSKCLT LFREFQDAIT KMHWKAPCFS GDGEWVIGGS  600
ASKGEHKIYI WDRAGHLVKI LEGPKEALID LVWHPVHPIV VSVSLTGLVY IWAKDYTENW  660
SAFAPDFKEL EENEEYIERE DEFDLIPEXE KVKDSDINED DEVDIVTVEK DSAFSDSDMS  720
QEELCFLPAI PSPDVLDPQD KCIESSSKLV DSNSGSPISE EGTPNGRAIN HASSPLEEDA  780
GATRLKRKRK PSEKGLEFQA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-141683673RADIALIS
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1784790LKRKRKP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.150390.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2535440.0AC253544.1 Prunus persica cultivar Lovell clone JGIBIXB-13B7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008363218.10.0PREDICTED: retinoblastoma-binding protein 5-like
SwissprotQ5E9150.0RBBP_ARATH; Protein RBL
TrEMBLM5WBL30.0M5WBL3_PRUPE; Uncharacterized protein
STRINGVIT_15s0021g01350.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.16e-64MYB family protein